Lineage for d1y2ea1 (1y2e A:86-411)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651135Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 651136Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 651168Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 651201Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 651202Species Human (Homo sapiens) [TaxId:9606] [89152] (20 PDB entries)
  8. 651223Domain d1y2ea1: 1y2e A:86-411 [122562]
    automatically matched to d1oyna_
    complexed with 5de, edo, mg, zn

Details for d1y2ea1

PDB Entry: 1y2e (more details), 2.1 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4D In Complex With 1-(4-amino-phenyl)-3,5-dimethyl-1H-pyrazole-4-carboxylic acid ethyl ester
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOP Domain Sequences for d1y2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2ea1 a.211.1.2 (A:86-411) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstip

SCOP Domain Coordinates for d1y2ea1:

Click to download the PDB-style file with coordinates for d1y2ea1.
(The format of our PDB-style files is described here.)

Timeline for d1y2ea1: