SCOPe 2.08: Domain d1y2ea_: 1y2e A:

Lineage for d1y2ea_ (1y2e A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
   Uniprot Q08499 388-713

8. Domain d1y2ea_: 1y2e A: [122562]
   automated match to d1oyna_
   complexed with 5de, edo, mg, zn

Details for d1y2ea_

PDB Entry: 1y2e, 2.1 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4D In Complex With 1-(4-amino-phenyl)-3,5-dimethyl-1H-pyrazole-4-carboxylic acid ethyl ester

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d1y2ea_:

Sequence; same for both SEQRES and ATOM records:

>d1y2ea_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstip

Timeline for d1y2ea_:

• d1y2ea_ first appeared in SCOP 1.73, called d1y2ea1
  
• d1y2ea_ appears in SCOPe 2.07