SCOPe 2.08: Domain d1y25b2: 1y25 B:3-165

Lineage for d1y25b2 (1y25 B:3-165)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thiol peroxidase Tpx [102452] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117600] (2 PDB entries)
   Uniprot P66952

8. Domain d1y25b2: 1y25 B:3-165 [122555]
   Other proteins in same PDB: d1y25a2, d1y25b3
   automated match to d1xvqa_
   complexed with act

Details for d1y25b2

PDB Entry: 1y25, 2.1 Å

PDB Description: structure of mycobacterial thiol peroxidase tpx

PDB Compounds: (B:) Probable thiol peroxidase

SCOPe Domain Sequences for d1y25b2:

Sequence; same for both SEQRES and ATOM records:

>d1y25b2 c.47.1.10 (B:3-165) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]}
qitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvsat
svrtfderaaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtiadg
pmagllaraivvigadgnvaytelvpeiaqepnyeaalaalga

Timeline for d1y25b2:

• d1y25b2 first appeared in SCOP 1.73, called d1y25b1
  
• d1y25b2 appears in SCOPe 2.07