Lineage for d1y1pb1 (1y1p B:2-343)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819885Protein Aldehyde reductase II [117413] (1 species)
  7. 819886Species Sporobolomyces salmonicolor [TaxId:5005] [117414] (3 PDB entries)
    Uniprot Q9UUN9
  8. 819888Domain d1y1pb1: 1y1p B:2-343 [122551]
    automatically matched to 1Y1P A:2-343
    complexed with act, amp, nmn, po4, so4

Details for d1y1pb1

PDB Entry: 1y1p (more details), 1.6 Å

PDB Description: X-ray structure of aldehyde reductase with NADPH
PDB Compounds: (B:) Aldehyde reductase II

SCOP Domain Sequences for d1y1pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1pb1 c.2.1.2 (B:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}
akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta

SCOP Domain Coordinates for d1y1pb1:

Click to download the PDB-style file with coordinates for d1y1pb1.
(The format of our PDB-style files is described here.)

Timeline for d1y1pb1: