Lineage for d1y1pb_ (1y1p B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. Protein Aldehyde reductase II [117413] (1 species)
  7. Species Sporobolomyces salmonicolor [TaxId:5005] [117414] (3 PDB entries)
    Uniprot Q9UUN9
  8. Domain d1y1pb_: 1y1p B: [122551]
    automated match to d1ujma_
    complexed with act, nmn, so4

    has additional subdomain(s) that are not in the common domain

Details for d1y1pb_

PDB Entry: 1y1p (more details), 1.6 Å

PDB Description: X-ray structure of aldehyde reductase with NADPH
PDB Compounds: (B:) Aldehyde reductase II

SCOPe Domain Sequences for d1y1pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1pb_ c.2.1.2 (B:) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}
akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta

SCOPe Domain Coordinates for d1y1pb_ are not available.

Timeline for d1y1pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y1pa1