Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (33 PDB entries) |
Domain d1y1ma_: 1y1m A: [122548] automated match to d1pb7a_ complexed with ac5 |
PDB Entry: 1y1m (more details), 1.8 Å
SCOPe Domain Sequences for d1y1ma_:
Sequence, based on SEQRES records: (download)
>d1y1ma_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwv
>d1y1ma_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgptvpqccygfcidllikl artmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivapltinneraqy iefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstm yrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigm rkdspwkqnvslsilkshengfmedldktwv
Timeline for d1y1ma_: