Lineage for d1y1jx1 (1y1j X:86-371)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 738417Family d.169.1.7: Sulfatase-modifying factor-like [143959] (2 proteins)
    Pfam PF03781 (DUF323); fold decorated with many additional structures; C-alpha-formyglycine-generating enzyme
  6. 738418Protein Sulfatase modifying factor 1 [143960] (1 species)
  7. 738419Species Human (Homo sapiens) [TaxId:9606] [143961] (14 PDB entries)
  8. 738424Domain d1y1jx1: 1y1j X:86-371 [122546]
    automatically matched to 1Y1E X:86-371
    complexed with ca, cxs, nag

Details for d1y1jx1

PDB Entry: 1y1j (more details), 1.55 Å

PDB Description: human formylglycine generating enzyme, sulfonic acid/desulfurated form
PDB Compounds: (X:) C-alpha-formyglycine-generating enzyme

SCOP Domain Sequences for d1y1jx1:

Sequence, based on SEQRES records: (download)

>d1y1jx1 d.169.1.7 (X:86-371) Sulfatase modifying factor 1 {Human (Homo sapiens) [TaxId: 9606]}
lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
lteaekfgdsfvfegmlseqvktniqqavaaapwwlpvkganwrhpegpdstilhrpdhp
vlhvswndavayctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgef
pvtntgedgfqgtapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgk
drvkkggsymchrsycyryrcaarsqntpdssasnlgfrcaadrlp

Sequence, based on observed residues (ATOM records): (download)

>d1y1jx1 d.169.1.7 (X:86-371) Sulfatase modifying factor 1 {Human (Homo sapiens) [TaxId: 9606]}
lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
lteaekfgdsfvfegmlsaaapwwlpvkganwrhpegpdstilhrpdhpvlhvswndava
yctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgefpvtntgedgfq
gtapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgkdrvkkggsymc
hrsycyryrcaarsqntpdssasnlgfrcaadrlp

SCOP Domain Coordinates for d1y1jx1:

Click to download the PDB-style file with coordinates for d1y1jx1.
(The format of our PDB-style files is described here.)

Timeline for d1y1jx1: