Lineage for d1y1ab1 (1y1a B:9-191)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 640891Protein Calcium- and integrin-binding protein, CIB [47541] (1 species)
  7. 640892Species Human (Homo sapiens) [TaxId:9606] [47542] (4 PDB entries)
  8. 640896Domain d1y1ab1: 1y1a B:9-191 [122538]
    automatically matched to d1dgua_
    complexed with ca, gsh

Details for d1y1ab1

PDB Entry: 1y1a (more details), 2.3 Å

PDB Description: crystal structure of calcium and integrin binding protein
PDB Compounds: (B:) Calcium and integrin binding 1 (calmyrin)

SCOP Domain Sequences for d1y1ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1ab1 a.39.1.5 (B:9-191) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
ivl

SCOP Domain Coordinates for d1y1ab1:

Click to download the PDB-style file with coordinates for d1y1ab1.
(The format of our PDB-style files is described here.)

Timeline for d1y1ab1: