SCOP 1.75: Domain d1y1aa1: 1y1a A:9-191

Lineage for d1y1aa1 (1y1a A:9-191)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium- and integrin-binding protein, CIB [47541] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47542] (4 PDB entries)
   Uniprot Q99828

8. Domain d1y1aa1: 1y1a A:9-191 [122537]
   automatically matched to d1dgua_
   complexed with ca, gsh

Details for d1y1aa1

PDB Entry: 1y1a, 2.3 Å

PDB Description: crystal structure of calcium and integrin binding protein

PDB Compounds: (A:) Calcium and integrin binding 1 (calmyrin)

SCOP Domain Sequences for d1y1aa1:

Sequence; same for both SEQRES and ATOM records:

>d1y1aa1 a.39.1.5 (A:9-191) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
ivl

Timeline for d1y1aa1:

• d1y1aa1 first appeared in SCOP 1.73
  
• d1y1aa1 is called d1y1aa_ in SCOPe 2.01
  
• d1y1aa1 appears in the current release, SCOPe 2.08, called d1y1aa_