![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (11 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calcium- and integrin-binding protein, CIB [47541] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47542] (4 PDB entries) |
![]() | Domain d1y1aa1: 1y1a A:9-191 [122537] automatically matched to d1dgua_ complexed with ca, gsh |
PDB Entry: 1y1a (more details), 2.3 Å
SCOP Domain Sequences for d1y1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y1aa1 a.39.1.5 (A:9-191) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk ivl
Timeline for d1y1aa1: