![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1y18e2: 1y18 E:108-212 [122530] Other proteins in same PDB: d1y18a1, d1y18b1, d1y18b2, d1y18c1, d1y18d1, d1y18d2, d1y18e1, d1y18f1, d1y18f2, d1y18h1, d1y18h2, d1y18l1 automatically matched to d1g9ml2 complexed with cl, han; mutant |
PDB Entry: 1y18 (more details), 2.8 Å
SCOP Domain Sequences for d1y18e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y18e2 b.1.1.2 (E:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1y18e2: