SCOP 1.75: Domain d1y17b1: 1y17 B:1-123

Lineage for d1y17b1 (1y17 B:1-123)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin beta chain [88867] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88871] (3 PDB entries)

8. Domain d1y17b1: 1y17 B:1-123 [122520]
   Other proteins in same PDB: d1y17a1
   automatically matched to d1iodb_
   complexed with ca

Details for d1y17b1

PDB Entry: 1y17, 2.4 Å

PDB Description: crystal structure of Aa-X-bp-II, a snake venom protein with the activity of binding to coagulation factor X from Agkistrodon acutus

PDB Compounds: (B:) anticoagulant protein-B

SCOP Domain Sequences for d1y17b1:

Sequence; same for both SEQRES and ATOM records:

>d1y17b1 d.169.1.1 (B:1-123) Snake coagglutinin beta chain {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa

Timeline for d1y17b1:

• d1y17b1 first appeared in SCOP 1.73
  
• d1y17b1 is called d1y17b_ in SCOPe 2.01
  
• d1y17b1 appears in the current release, SCOPe 2.08, called d1y17b_