Lineage for d1y17b1 (1y17 B:1-123)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738201Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 738227Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88871] (3 PDB entries)
  8. 738230Domain d1y17b1: 1y17 B:1-123 [122520]
    Other proteins in same PDB: d1y17a1
    automatically matched to d1iodb_
    complexed with ca

Details for d1y17b1

PDB Entry: 1y17 (more details), 2.4 Å

PDB Description: crystal structure of Aa-X-bp-II, a snake venom protein with the activity of binding to coagulation factor X from Agkistrodon acutus
PDB Compounds: (B:) anticoagulant protein-B

SCOP Domain Sequences for d1y17b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y17b1 d.169.1.1 (B:1-123) Snake coagglutinin beta chain {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa

SCOP Domain Coordinates for d1y17b1:

Click to download the PDB-style file with coordinates for d1y17b1.
(The format of our PDB-style files is described here.)

Timeline for d1y17b1: