| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Snake coagglutinin beta chain [88867] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
| Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88871] (3 PDB entries) |
| Domain d1y17b_: 1y17 B: [122520] Other proteins in same PDB: d1y17a1 automated match to d1iodb_ complexed with ca |
PDB Entry: 1y17 (more details), 2.4 Å
SCOPe Domain Sequences for d1y17b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y17b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa
Timeline for d1y17b_: