SCOPe 2.01: Domain d1y17a1: 1y17 A:1-129

Lineage for d1y17a1 (1y17 A:1-129)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId:36307] [88865] (3 PDB entries)

8. Domain d1y17a1: 1y17 A:1-129 [122519]
   Other proteins in same PDB: d1y17b_
   complexed with ca

Details for d1y17a1

PDB Entry: 1y17, 2.4 Å

PDB Description: crystal structure of Aa-X-bp-II, a snake venom protein with the activity of binding to coagulation factor X from Agkistrodon acutus

PDB Compounds: (A:) anticoagulant protein A

SCOPe Domain Sequences for d1y17a1:

Sequence; same for both SEQRES and ATOM records:

>d1y17a1 d.169.1.1 (A:1-129) Snake coagglutinin alpha chain {Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId: 36307]}
dcssswssyeghcykafkqsktwadaesfctkqvngghlvsiessgeadfvahliaqkik
sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhkatgfrkwenfyce
qrdpfvcea

Timeline for d1y17a1:

• d1y17a1 first appeared in SCOP 1.73
  
• d1y17a1 appears in SCOP 1.75
  
• d1y17a1 appears in SCOPe 2.02
  
• d1y17a1 appears in the current release, SCOPe 2.08