![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.157: Hcp1-like [141451] (1 superfamily) barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus |
![]() | Superfamily b.157.1: Hcp1-like [141452] (2 families) ![]() probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets |
![]() | Family b.157.1.1: Hcp1-like [141453] (1 protein) Pfam PF05638; DUF796 |
![]() | Protein Hemolysin-corregulated protein 1, Hcp1 [141454] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [141455] (1 PDB entry) Uniprot Q9I747 2-162 PA0085 |
![]() | Domain d1y12c_: 1y12 C: [122518] automated match to d1y12a1 |
PDB Entry: 1y12 (more details), 1.95 Å
SCOPe Domain Sequences for d1y12c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y12c_ b.157.1.1 (C:) Hemolysin-corregulated protein 1, Hcp1 {Pseudomonas aeruginosa [TaxId: 287]} avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdlsftky idkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrl tenvtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa
Timeline for d1y12c_: