Lineage for d1y12b_ (1y12 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089236Fold b.157: Hcp1-like [141451] (1 superfamily)
    barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus
  4. 2089237Superfamily b.157.1: Hcp1-like [141452] (2 families) (S)
    probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets
  5. 2089238Family b.157.1.1: Hcp1-like [141453] (1 protein)
    Pfam PF05638; DUF796
  6. 2089239Protein Hemolysin-corregulated protein 1, Hcp1 [141454] (1 species)
  7. 2089240Species Pseudomonas aeruginosa [TaxId:287] [141455] (1 PDB entry)
    Uniprot Q9I747 2-162
    PA0085
  8. 2089242Domain d1y12b_: 1y12 B: [122517]
    automated match to d1y12a1

Details for d1y12b_

PDB Entry: 1y12 (more details), 1.95 Å

PDB Description: structure of a hemolysin-coregulated protein from pseudomonas aeruginosa
PDB Compounds: (B:) hypothetical protein PA0085

SCOPe Domain Sequences for d1y12b_:

Sequence, based on SEQRES records: (download)

>d1y12b_ b.157.1.1 (B:) Hemolysin-corregulated protein 1, Hcp1 {Pseudomonas aeruginosa [TaxId: 287]}
avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdlsftky
idkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrl
tenvtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa

Sequence, based on observed residues (ATOM records): (download)

>d1y12b_ b.157.1.1 (B:) Hemolysin-corregulated protein 1, Hcp1 {Pseudomonas aeruginosa [TaxId: 287]}
avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmagkvnvqdlsftkyidkst
pnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrltenvt
lnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa

SCOPe Domain Coordinates for d1y12b_:

Click to download the PDB-style file with coordinates for d1y12b_.
(The format of our PDB-style files is described here.)

Timeline for d1y12b_: