SCOPe 2.08: Domain d1y12b_: 1y12 B:

Lineage for d1y12b_ (1y12 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.157: Hcp1-like [141451] (1 superfamily)
   barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus

4. Superfamily b.157.1: Hcp1-like [141452] (2 families)
   probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets

5. Family b.157.1.1: Hcp1-like [141453] (1 protein)
   Pfam PF05638; DUF796

6. Protein Hemolysin-corregulated protein 1, Hcp1 [141454] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141455] (1 PDB entry)
   Uniprot Q9I747 2-162
   PA0085

8. Domain d1y12b_: 1y12 B: [122517]
   automated match to d1y12a1

Details for d1y12b_

PDB Entry: 1y12, 1.95 Å

PDB Description: structure of a hemolysin-coregulated protein from pseudomonas aeruginosa

PDB Compounds: (B:) hypothetical protein PA0085

SCOPe Domain Sequences for d1y12b_:

Sequence, based on SEQRES records:

>d1y12b_ b.157.1.1 (B:) Hemolysin-corregulated protein 1, Hcp1 {Pseudomonas aeruginosa [TaxId: 287]}
avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdlsftky
idkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrl
tenvtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa

Sequence, based on observed residues (ATOM records):

>d1y12b_ b.157.1.1 (B:) Hemolysin-corregulated protein 1, Hcp1 {Pseudomonas aeruginosa [TaxId: 287]}
avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmagkvnvqdlsftkyidkst
pnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrltenvt
lnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa

Timeline for d1y12b_:

• d1y12b_ first appeared in SCOP 1.73, called d1y12b1
  
• d1y12b_ appears in SCOPe 2.07