Lineage for d1y12a1 (1y12 A:2-162)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680972Fold b.157: Hcp1-like [141451] (1 superfamily)
    barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus
  4. 680973Superfamily b.157.1: Hcp1-like [141452] (1 family) (S)
    probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets
  5. 680974Family b.157.1.1: Hcp1-like [141453] (1 protein)
    Pfam PF05638; DUF796
  6. 680975Protein Hemolysin-corregulated protein 1, Hcp1 [141454] (1 species)
  7. 680976Species Pseudomonas aeruginosa [TaxId:287] [141455] (1 PDB entry)
    PA0085
  8. 680977Domain d1y12a1: 1y12 A:2-162 [122516]

Details for d1y12a1

PDB Entry: 1y12 (more details), 1.95 Å

PDB Description: structure of a hemolysin-coregulated protein from pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA0085

SCOP Domain Sequences for d1y12a1:

Sequence, based on SEQRES records: (download)

>d1y12a1 b.157.1.1 (A:2-162) Hemolysin-corregulated protein 1, Hcp1 {Pseudomonas aeruginosa [TaxId: 287]}
avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdlsftky
idkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrl
tenvtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa

Sequence, based on observed residues (ATOM records): (download)

>d1y12a1 b.157.1.1 (A:2-162) Hemolysin-corregulated protein 1, Hcp1 {Pseudomonas aeruginosa [TaxId: 287]}
avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmggggagkvnvqdlsftkyi
dkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrlt
envtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa

SCOP Domain Coordinates for d1y12a1:

Click to download the PDB-style file with coordinates for d1y12a1.
(The format of our PDB-style files is described here.)

Timeline for d1y12a1: