Lineage for d1y0ya2 (1y0y A:164-351,A:6-72)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703198Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 703272Protein Frv operon protein FrvX, catalytic domain [117659] (1 species)
  7. 703273Species Pyrococcus horikoshii [TaxId:53953] [117660] (3 PDB entries)
  8. 703274Domain d1y0ya2: 1y0y A:164-351,A:6-72 [122515]
    Other proteins in same PDB: d1y0ya1
    automatically matched to 1Y0R A:164-351,A:6-72
    complexed with ati, zn

Details for d1y0ya2

PDB Entry: 1y0y (more details), 1.6 Å

PDB Description: Crystal structure of tetrahedral aminopeptidase from P. horikoshii in complex with amastatin
PDB Compounds: (A:) Frv operon protein FrvX

SCOP Domain Sequences for d1y0ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ya2 c.56.5.4 (A:164-351,A:6-72) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
wdgrlerlgkhrfvsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsa
fgiepdygfaidvtiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakk
heipyqleillgggtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtk
alenihelXmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
kgegpkvmiaahmdqi

SCOP Domain Coordinates for d1y0ya2:

Click to download the PDB-style file with coordinates for d1y0ya2.
(The format of our PDB-style files is described here.)

Timeline for d1y0ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y0ya1