SCOP 1.73: Domain d1y0ya2: 1y0y A:164-351,A:6-72

Lineage for d1y0ya2 (1y0y A:164-351,A:6-72)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)

6. Protein Frv operon protein FrvX, catalytic domain [117659] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [117660] (3 PDB entries)

8. Domain d1y0ya2: 1y0y A:164-351,A:6-72 [122515]
   Other proteins in same PDB: d1y0ya1
   automatically matched to 1Y0R A:164-351,A:6-72
   complexed with ati, zn

Details for d1y0ya2

PDB Entry: 1y0y, 1.6 Å

PDB Description: Crystal structure of tetrahedral aminopeptidase from P. horikoshii in complex with amastatin

PDB Compounds: (A:) Frv operon protein FrvX

SCOP Domain Sequences for d1y0ya2:

Sequence; same for both SEQRES and ATOM records:

>d1y0ya2 c.56.5.4 (A:164-351,A:6-72) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
wdgrlerlgkhrfvsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsa
fgiepdygfaidvtiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakk
heipyqleillgggtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtk
alenihelXmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
kgegpkvmiaahmdqi

Timeline for d1y0ya2:

• d1y0ya2 is new in SCOP 1.73
  
• d1y0ya2 last appears in SCOP 1.75