SCOP 1.73: Domain d1y0ya1: 1y0y A:73-163

Lineage for d1y0ya1 (1y0y A:73-163)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family)

5. Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)

6. Protein Frv operon protein FrvX [117239] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [117240] (3 PDB entries)

8. Domain d1y0ya1: 1y0y A:73-163 [122514]
   Other proteins in same PDB: d1y0ya2
   automatically matched to 1Y0R A:73-163
   complexed with ati, zn

Details for d1y0ya1

PDB Entry: 1y0y, 1.6 Å

PDB Description: Crystal structure of tetrahedral aminopeptidase from P. horikoshii in complex with amastatin

PDB Compounds: (A:) Frv operon protein FrvX

SCOP Domain Sequences for d1y0ya1:

Sequence, based on SEQRES records:

>d1y0ya1 b.49.3.1 (A:73-163) Frv operon protein FrvX {Pyrococcus horikoshii [TaxId: 53953]}
glmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpphiqkpedrkk
apdwdqifidigaeskeeaedmgvkigtvit

Sequence, based on observed residues (ATOM records):

>d1y0ya1 b.49.3.1 (A:73-163) Frv operon protein FrvX {Pyrococcus horikoshii [TaxId: 53953]}
glmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasapdwdqifidiga
eskeeaedmgvkigtvit

Timeline for d1y0ya1:

• d1y0ya1 is new in SCOP 1.73
  
• d1y0ya1 appears in SCOP 1.75
  
• d1y0ya1 appears in the current release, SCOPe 2.08