Lineage for d1y0sb_ (1y0s B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48527] (37 PDB entries)
  8. Domain d1y0sb_: 1y0s B: [122513]
    automated match to d1gwxa_
    complexed with 331, b7g, iod

Details for d1y0sb_

PDB Entry: 1y0s (more details), 2.65 Å

PDB Description: crystal structure of ppar delta complexed with gw2331
PDB Compounds: (B:) Peroxisome proliferator activated receptor delta

SCOPe Domain Sequences for d1y0sb_:

Sequence, based on SEQRES records: (download)

>d1y0sb_ a.123.1.1 (B:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
adlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlv
nglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifa
mlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfi
aaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvte
haqmmqrikktetetslhpllqeiykdm

Sequence, based on observed residues (ATOM records): (download)

>d1y0sb_ a.123.1.1 (B:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
adlkafskhiynaylknfnmtkkkarsiltgapfvihdietlwqaekglvwglppykeis
vhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdg
llvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrp
glmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikk
tetetslhpllqeiykdm

SCOPe Domain Coordinates for d1y0sb_ are not available.

Timeline for d1y0sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y0sa_