Lineage for d1y0sa_ (1y0s A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009141Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 2009142Species Human (Homo sapiens) [TaxId:9606] [48527] (16 PDB entries)
  8. 2009153Domain d1y0sa_: 1y0s A: [122512]
    automated match to d1gwxa_
    complexed with 331, b7g, iod

Details for d1y0sa_

PDB Entry: 1y0s (more details), 2.65 Å

PDB Description: Crystal structure of PPAR delta complexed with GW2331
PDB Compounds: (A:) Peroxisome proliferator activated receptor delta

SCOPe Domain Sequences for d1y0sa_:

Sequence, based on SEQRES records: (download)

>d1y0sa_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
pqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwk
qlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhea
ifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdla
lfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrql
vtehaqmmqrikktetetslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d1y0sa_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
pqvadlkafskhiynaylknfnmtkkkarsiltgapfvihdietlwqaekglvwglppyk
eisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivn
kdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcg
drpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqr
ikktetetslhpllqeiykd

SCOPe Domain Coordinates for d1y0sa_:

Click to download the PDB-style file with coordinates for d1y0sa_.
(The format of our PDB-style files is described here.)

Timeline for d1y0sa_: