Lineage for d1y0ra1 (1y0r A:73-163)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2799068Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 2799069Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 2799099Protein Frv operon protein FrvX [117239] (1 species)
  7. 2799100Species Pyrococcus horikoshii [TaxId:53953] [117240] (3 PDB entries)
    Uniprot O59196 # PH1527
  8. 2799102Domain d1y0ra1: 1y0r A:73-163 [122510]
    Other proteins in same PDB: d1y0ra3
    complexed with ars, zn

Details for d1y0ra1

PDB Entry: 1y0r (more details), 1.75 Å

PDB Description: Crystal structure of the tetrahedral aminopeptidase from P. horikoshii
PDB Compounds: (A:) Frv operon protein FrvX

SCOPe Domain Sequences for d1y0ra1:

Sequence, based on SEQRES records: (download)

>d1y0ra1 b.49.3.1 (A:73-163) Frv operon protein FrvX {Pyrococcus horikoshii [TaxId: 53953]}
glmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpphiqkpedrkk
apdwdqifidigaeskeeaedmgvkigtvit

Sequence, based on observed residues (ATOM records): (download)

>d1y0ra1 b.49.3.1 (A:73-163) Frv operon protein FrvX {Pyrococcus horikoshii [TaxId: 53953]}
glmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasapdwdqifidiga
eskeeaedmgvkigtvit

SCOPe Domain Coordinates for d1y0ra1:

Click to download the PDB-style file with coordinates for d1y0ra1.
(The format of our PDB-style files is described here.)

Timeline for d1y0ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y0ra3