Lineage for d1y0pa3 (1y0p A:360-505)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234542Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 2234543Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 2234544Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 2234551Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
    contains additional N-terminal multiheme domain
  7. 2234552Species Shewanella frigidimarina [TaxId:56812] [56433] (16 PDB entries)
  8. 2234553Domain d1y0pa3: 1y0p A:360-505 [122509]
    Other proteins in same PDB: d1y0pa1, d1y0pa2
    automated match to d1qjda3
    complexed with fad, hem, mez, na

Details for d1y0pa3

PDB Entry: 1y0p (more details), 1.5 Å

PDB Description: Flavocytochrome c3 with mesaconate bound
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1y0pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0pa3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
qyiqahptlsvkggvmvteavrgngailvnregkrfvneittrdkasaailaqtgksayl
ifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtd
ferpnlpralnegnyyaievtpgvhh

SCOPe Domain Coordinates for d1y0pa3:

Click to download the PDB-style file with coordinates for d1y0pa3.
(The format of our PDB-style files is described here.)

Timeline for d1y0pa3: