SCOP 1.73: Domain d1y0pa3: 1y0p A:362-504

Lineage for d1y0pa3 (1y0p A:362-504)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
   unusual fold

4. Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family)

5. Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)

6. Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
   contains additional N-terminal multiheme domain

7. Species Shewanella frigidimarina [TaxId:56812] [56433] (16 PDB entries)

8. Domain d1y0pa3: 1y0p A:362-504 [122509]
   Other proteins in same PDB: d1y0pa1, d1y0pa2
   automatically matched to d1kssa3
   complexed with fad, hem, mez, na

Details for d1y0pa3

PDB Entry: 1y0p, 1.5 Å

PDB Description: Flavocytochrome c3 with mesaconate bound

PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOP Domain Sequences for d1y0pa3:

Sequence; same for both SEQRES and ATOM records:

>d1y0pa3 d.168.1.1 (A:362-504) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
iqahptlsvkggvmvteavrgngailvnregkrfvneittrdkasaailaqtgksaylif
ddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfe
rpnlpralnegnyyaievtpgvh

Timeline for d1y0pa3:

• d1y0pa3 is new in SCOP 1.73
  
• d1y0pa3 appears in SCOP 1.75
  
• d1y0pa3 appears in the current release, SCOPe 2.08