Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1y0ll2: 1y0l L:108-212 [122501] Other proteins in same PDB: d1y0la1, d1y0lb1, d1y0lb2, d1y0lc1, d1y0ld1, d1y0ld2, d1y0le1, d1y0lf1, d1y0lf2, d1y0lh1, d1y0lh2, d1y0ll1 automatically matched to d1g9ml2 complexed with cl, han |
PDB Entry: 1y0l (more details), 2.5 Å
SCOP Domain Sequences for d1y0ll2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0ll2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1y0ll2: