SCOPe 2.08: Domain d1y0ld2: 1y0l D:114-233

Lineage for d1y0ld2 (1y0l D:114-233)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1y0ld2: 1y0l D:114-233 [122493]
   Other proteins in same PDB: d1y0la1, d1y0la2, d1y0lb1, d1y0lc1, d1y0lc2, d1y0ld1, d1y0le1, d1y0le2, d1y0lf1, d1y0lh1, d1y0ll1, d1y0ll2
   automatically matched to d1aqkh2
   complexed with cl, han

Details for d1y0ld2

PDB Entry: 1y0l, 2.5 Å

PDB Description: Catalytic elimination antibody 34E4 in complex with hapten

PDB Compounds: (D:) Catalytic Antibody Fab 34E4 Heavy chain

SCOPe Domain Sequences for d1y0ld2:

Sequence; same for both SEQRES and ATOM records:

>d1y0ld2 b.1.1.2 (D:114-233) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1y0ld2:

• d1y0ld2 first appeared in SCOP 1.73
  
• d1y0ld2 appears in SCOPe 2.07