SCOPe 2.04: Domain d1y0lc2: 1y0l C:108-212

Lineage for d1y0lc2 (1y0l C:108-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1y0lc2: 1y0l C:108-212 [122491]
   Other proteins in same PDB: d1y0la1, d1y0lb1, d1y0lb2, d1y0lc1, d1y0ld1, d1y0ld2, d1y0le1, d1y0lf1, d1y0lf2, d1y0lh1, d1y0lh2, d1y0ll1
   automatically matched to d1g9ml2
   complexed with cl, han

Details for d1y0lc2

PDB Entry: 1y0l, 2.5 Å

PDB Description: Catalytic elimination antibody 34E4 in complex with hapten

PDB Compounds: (C:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d1y0lc2:

Sequence; same for both SEQRES and ATOM records:

>d1y0lc2 b.1.1.2 (C:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1y0lc2:

• d1y0lc2 first appeared in SCOP 1.73
  
• d1y0lc2 appears in SCOPe 2.03
  
• d1y0lc2 appears in SCOPe 2.05
  
• d1y0lc2 appears in the current release, SCOPe 2.08