Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d1y0lc2: 1y0l C:108-212 [122491] Other proteins in same PDB: d1y0la1, d1y0lb1, d1y0lb2, d1y0lc1, d1y0ld1, d1y0ld2, d1y0le1, d1y0lf1, d1y0lf2, d1y0lh1, d1y0lh2, d1y0ll1 automatically matched to d1g9ml2 complexed with cl, han |
PDB Entry: 1y0l (more details), 2.5 Å
SCOPe Domain Sequences for d1y0lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0lc2 b.1.1.2 (C:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1y0lc2: