SCOPe 2.08: Domain d1y0ka1: 1y0k A:1-209

Lineage for d1y0ka1 (1y0k A:1-209)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.31: PA4535-like [142449] (1 protein)
   contains the PD motif at the beginning of strand 2 and putative catalytic glutamate in strand 3, whereas the putative catalytic lysine is migrated to an alpha-helix
   automatically mapped to Pfam PF08682

6. Protein Hypothetical protein PA4535 [142450] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142451] (1 PDB entry)
   Uniprot Q9HVP2 1-209

8. Domain d1y0ka1: 1y0k A:1-209 [122485]

Details for d1y0ka1

PDB Entry: 1y0k, 1.75 Å

PDB Description: Structure of Protein of Unknown Function PA4535 from Pseudomonas aeruginosa strain PAO1, Monooxygenase Superfamily

PDB Compounds: (A:) hypothetical protein PA4535

SCOPe Domain Sequences for d1y0ka1:

Sequence, based on SEQRES records:

>d1y0ka1 c.52.1.31 (A:1-209) Hypothetical protein PA4535 {Pseudomonas aeruginosa [TaxId: 287]}
mneadylrlltrqaeqandflsnarkwdrerwvcqrflealnvpyrqedfaapgeqppdv
lfkgagfevffvldegrrlneewreeltrrrqavslrqlirreerpqriaaaelqarlap
tlrkkahnysergidhgeldllafvnlkravpdfntpfpppteylrqgwrslsmvgptfa
rvlfahsgapeflranlgrsilfdagvgl

Sequence, based on observed residues (ATOM records):

>d1y0ka1 c.52.1.31 (A:1-209) Hypothetical protein PA4535 {Pseudomonas aeruginosa [TaxId: 287]}
mneadylrlltrqaeqandflsnarkwdrerwvcqrflealnvpyrqedfaapgeqppdv
lfkgagfevffvlderpqriaaaelqarlaptlrkkahnysergidhgeldllafvnlkr
avpdfntpfpppteylrqgwrslsmvgptfarvlfahsgapeflranlgrsilfdagvgl

Timeline for d1y0ka1:

• d1y0ka1 first appeared in SCOP 1.73
  
• d1y0ka1 appears in SCOPe 2.07