Lineage for d1y0ka1 (1y0k A:1-209)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121549Family c.52.1.31: PA4535-like [142449] (1 protein)
    contains the PD motif at the beginning of strand 2 and putative catalytic glutamate in strand 3, whereas the putative catalytic lysine is migrated to an alpha-helix
    automatically mapped to Pfam PF08682
  6. 2121550Protein Hypothetical protein PA4535 [142450] (1 species)
  7. 2121551Species Pseudomonas aeruginosa [TaxId:287] [142451] (1 PDB entry)
    Uniprot Q9HVP2 1-209
  8. 2121552Domain d1y0ka1: 1y0k A:1-209 [122485]

Details for d1y0ka1

PDB Entry: 1y0k (more details), 1.75 Å

PDB Description: Structure of Protein of Unknown Function PA4535 from Pseudomonas aeruginosa strain PAO1, Monooxygenase Superfamily
PDB Compounds: (A:) hypothetical protein PA4535

SCOPe Domain Sequences for d1y0ka1:

Sequence, based on SEQRES records: (download)

>d1y0ka1 c.52.1.31 (A:1-209) Hypothetical protein PA4535 {Pseudomonas aeruginosa [TaxId: 287]}
mneadylrlltrqaeqandflsnarkwdrerwvcqrflealnvpyrqedfaapgeqppdv
lfkgagfevffvldegrrlneewreeltrrrqavslrqlirreerpqriaaaelqarlap
tlrkkahnysergidhgeldllafvnlkravpdfntpfpppteylrqgwrslsmvgptfa
rvlfahsgapeflranlgrsilfdagvgl

Sequence, based on observed residues (ATOM records): (download)

>d1y0ka1 c.52.1.31 (A:1-209) Hypothetical protein PA4535 {Pseudomonas aeruginosa [TaxId: 287]}
mneadylrlltrqaeqandflsnarkwdrerwvcqrflealnvpyrqedfaapgeqppdv
lfkgagfevffvlderpqriaaaelqarlaptlrkkahnysergidhgeldllafvnlkr
avpdfntpfpppteylrqgwrslsmvgptfarvlfahsgapeflranlgrsilfdagvgl

SCOPe Domain Coordinates for d1y0ka1:

Click to download the PDB-style file with coordinates for d1y0ka1.
(The format of our PDB-style files is described here.)

Timeline for d1y0ka1: