Lineage for d1y0jb1 (1y0j B:1-36)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462985Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1462986Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1463309Family g.37.1.2: C2HC finger [57697] (3 proteins)
  6. 1463317Protein U-shaped transcription factor, different fingers [57698] (1 species)
  7. 1463318Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (4 PDB entries)
  8. 1463319Domain d1y0jb1: 1y0j B:1-36 [122484]
    Other proteins in same PDB: d1y0ja1
    automatically matched to d1fv5a_
    protein/DNA complex; complexed with zn

Details for d1y0jb1

PDB Entry: 1y0j (more details)

PDB Description: zinc fingers as protein recognition motifs: structural basis for the gata-1/friend of gata interaction
PDB Compounds: (B:) Zinc-finger protein ush

SCOPe Domain Sequences for d1y0jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gsllkparfmclpcgiafsspstleahqayycshri

SCOPe Domain Coordinates for d1y0jb1:

Click to download the PDB-style file with coordinates for d1y0jb1.
(The format of our PDB-style files is described here.)

Timeline for d1y0jb1: