Lineage for d1y0jb1 (1y0j B:1-36)
- Root: SCOPe 2.03
Class g: Small proteins [56992] (90 folds) 
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHCSuperfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) 
Family g.37.1.2: C2HC finger [57697] (3 proteins) Protein U-shaped transcription factor, different fingers [57698] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (4 PDB entries) 
Domain d1y0jb1: 1y0j B:1-36 [122484]
Other proteins in same PDB: d1y0ja1
automatically matched to d1fv5a_
protein/DNA complex; complexed with zn
Details for d1y0jb1
PDB Entry: 1y0j (more details)
PDB Description: zinc fingers as protein recognition motifs: structural basis for the gata-1/friend of gata interaction
PDB Compounds: (B:) Zinc-finger protein ushSCOPe Domain Sequences for d1y0jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gsllkparfmclpcgiafsspstleahqayycshri
SCOPe Domain Coordinates for d1y0jb1:
Click to download the PDB-style file with coordinates for d1y0jb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y0jb1:
- d1y0jb1 first appeared in SCOP 1.73
- d1y0jb1 appears in SCOPe 2.02
- d1y0jb1 is called d1y0jb_ in SCOPe 2.04
- d1y0jb1 appears in the current release, SCOPe 2.08, called d1y0jb2
View in 3D
