Lineage for d1y0ja1 (1y0j A:200-238)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892409Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
    single zinc-binding motif
  6. 892410Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 892445Species Mouse (Mus musculus) [TaxId:10090] [57720] (2 PDB entries)
  8. 892446Domain d1y0ja1: 1y0j A:200-238 [122483]
    Other proteins in same PDB: d1y0jb1
    automatically matched to d1gnf__
    complexed with zn

Details for d1y0ja1

PDB Entry: 1y0j (more details)

PDB Description: zinc fingers as protein recognition motifs: structural basis for the gata-1/friend of gata interaction
PDB Compounds: (A:) Erythroid transcription factor

SCOP Domain Sequences for d1y0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]}
earecvncgatatplwrrdrtghylcnacglyhkmngqn

SCOP Domain Coordinates for d1y0ja1:

Click to download the PDB-style file with coordinates for d1y0ja1.
(The format of our PDB-style files is described here.)

Timeline for d1y0ja1: