| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
| Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
| Protein Xanthine phosphoribosyltransferase [142556] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries) Uniprot P42085 1-191 |
| Domain d1y0bd2: 1y0b D:1-191 [122479] Other proteins in same PDB: d1y0ba2, d1y0bb3, d1y0bc3, d1y0bd3 automated match to d1y0ba1 complexed with g4p, na |
PDB Entry: 1y0b (more details), 1.8 Å
SCOPe Domain Sequences for d1y0bd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0bd2 c.61.1.1 (D:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfvqe
Timeline for d1y0bd2: