SCOP 1.73: Domain d1y0bd1: 1y0b D:1-191

Lineage for d1y0bd1 (1y0b D:1-191)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)

6. Protein Xanthine phosphoribosyltransferase [142556] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)

8. Domain d1y0bd1: 1y0b D:1-191 [122479]
   automatically matched to 1Y0B A:1-191
   complexed with g4p, na

Details for d1y0bd1

PDB Entry: 1y0b, 1.8 Å

PDB Description: crystal structure of xanthine phosphoribosyltransferase from bacillus subtilis.

PDB Compounds: (D:) Xanthine phosphoribosyltransferase

SCOP Domain Sequences for d1y0bd1:

Sequence; same for both SEQRES and ATOM records:

>d1y0bd1 c.61.1.1 (D:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfvqe

Timeline for d1y0bd1:

• d1y0bd1 is new in SCOP 1.73
  
• d1y0bd1 appears in SCOP 1.75
  
• d1y0bd1 appears in the current release, SCOPe 2.07, called d1y0bd2