![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (2 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins) |
![]() | Protein Xanthine phosphoribosyltransferase [142556] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries) |
![]() | Domain d1y0bd1: 1y0b D:1-191 [122479] automatically matched to 1Y0B A:1-191 complexed with g4p, na |
PDB Entry: 1y0b (more details), 1.8 Å
SCOP Domain Sequences for d1y0bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0bd1 c.61.1.1 (D:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs leegkvsfvqe
Timeline for d1y0bd1: