Lineage for d1y0bc_ (1y0b C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1377621Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1377622Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1377623Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1377897Protein Xanthine phosphoribosyltransferase [142556] (1 species)
  7. 1377898Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)
    Uniprot P42085 1-191
  8. 1377901Domain d1y0bc_: 1y0b C: [122478]
    automated match to d1y0ba1
    complexed with g4p, na

Details for d1y0bc_

PDB Entry: 1y0b (more details), 1.8 Å

PDB Description: crystal structure of xanthine phosphoribosyltransferase from bacillus subtilis.
PDB Compounds: (C:) Xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1y0bc_:

Sequence, based on SEQRES records: (download)

>d1y0bc_ c.61.1.1 (C:) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
essgiapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdq
dhvliiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslar
iqsleegkvsfv

Sequence, based on observed residues (ATOM records): (download)

>d1y0bc_ c.61.1.1 (C:) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
essgiapavmtglklgvpvvfarkhksltltdnlltasvysftesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfv

SCOPe Domain Coordinates for d1y0bc_:

Click to download the PDB-style file with coordinates for d1y0bc_.
(The format of our PDB-style files is described here.)

Timeline for d1y0bc_: