Lineage for d1y0bc1 (1y0b C:1-189)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703952Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 703953Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 703954Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 704217Protein Xanthine phosphoribosyltransferase [142556] (1 species)
  7. 704218Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)
  8. 704221Domain d1y0bc1: 1y0b C:1-189 [122478]
    automatically matched to 1Y0B A:1-191
    complexed with g4p, na

Details for d1y0bc1

PDB Entry: 1y0b (more details), 1.8 Å

PDB Description: crystal structure of xanthine phosphoribosyltransferase from bacillus subtilis.
PDB Compounds: (C:) Xanthine phosphoribosyltransferase

SCOP Domain Sequences for d1y0bc1:

Sequence, based on SEQRES records: (download)

>d1y0bc1 c.61.1.1 (C:1-189) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfv

Sequence, based on observed residues (ATOM records): (download)

>d1y0bc1 c.61.1.1 (C:1-189) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftesqiavsgthlsdqdhvlii
ddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqslee
gkvsfv

SCOP Domain Coordinates for d1y0bc1:

Click to download the PDB-style file with coordinates for d1y0bc1.
(The format of our PDB-style files is described here.)

Timeline for d1y0bc1: