Lineage for d1y0bc2 (1y0b C:1-189)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891690Protein Xanthine phosphoribosyltransferase [142556] (1 species)
  7. 2891691Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)
    Uniprot P42085 1-191
  8. 2891696Domain d1y0bc2: 1y0b C:1-189 [122478]
    Other proteins in same PDB: d1y0ba2, d1y0bb3, d1y0bc3, d1y0bd3
    automated match to d1y0ba1
    complexed with g4p, na

Details for d1y0bc2

PDB Entry: 1y0b (more details), 1.8 Å

PDB Description: crystal structure of xanthine phosphoribosyltransferase from bacillus subtilis.
PDB Compounds: (C:) Xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1y0bc2:

Sequence, based on SEQRES records: (download)

>d1y0bc2 c.61.1.1 (C:1-189) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfv

Sequence, based on observed residues (ATOM records): (download)

>d1y0bc2 c.61.1.1 (C:1-189) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftesqiavsgthlsdqdhvlii
ddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqslee
gkvsfv

SCOPe Domain Coordinates for d1y0bc2:

Click to download the PDB-style file with coordinates for d1y0bc2.
(The format of our PDB-style files is described here.)

Timeline for d1y0bc2: