Lineage for d1y0bb_ (1y0b B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863466Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1863779Protein Xanthine phosphoribosyltransferase [142556] (1 species)
  7. 1863780Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)
    Uniprot P42085 1-191
  8. 1863782Domain d1y0bb_: 1y0b B: [122477]
    automated match to d1y0ba1
    complexed with g4p, na

Details for d1y0bb_

PDB Entry: 1y0b (more details), 1.8 Å

PDB Description: crystal structure of xanthine phosphoribosyltransferase from bacillus subtilis.
PDB Compounds: (B:) Xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1y0bb_:

Sequence, based on SEQRES records: (download)

>d1y0bb_ c.61.1.1 (B:) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
essgiapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdq
dhvliiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslar
iqsleegkvsfvqev

Sequence, based on observed residues (ATOM records): (download)

>d1y0bb_ c.61.1.1 (B:) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
essgiapavmtglklgvpvvfarkhksltltdnlltasvysftesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfvqev

SCOPe Domain Coordinates for d1y0bb_:

Click to download the PDB-style file with coordinates for d1y0bb_.
(The format of our PDB-style files is described here.)

Timeline for d1y0bb_: