Lineage for d1xzob_ (1xzo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118053Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2118330Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)
  7. 2118331Species Bacillus subtilis [TaxId:1423] [102460] (2 PDB entries)
  8. 2118333Domain d1xzob_: 1xzo B: [122475]
    automated match to d1on4a_
    complexed with ca, cd

Details for d1xzob_

PDB Entry: 1xzo (more details), 1.7 Å

PDB Description: identification of a disulfide switch in bssco, a member of the sco family of cytochrome c oxidase assembly proteins
PDB Compounds: (B:) Hypothetical protein ypmQ

SCOPe Domain Sequences for d1xzob_:

Sequence, based on SEQRES records: (download)

>d1xzob_ c.47.1.10 (B:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}
qqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkk
lkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfka
ivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk

Sequence, based on observed residues (ATOM records): (download)

>d1xzob_ c.47.1.10 (B:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}
qqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkk
lkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfka
ivkkpegdqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk

SCOPe Domain Coordinates for d1xzob_:

Click to download the PDB-style file with coordinates for d1xzob_.
(The format of our PDB-style files is described here.)

Timeline for d1xzob_: