SCOPe 2.08: Domain d1xzob_: 1xzo B:

Lineage for d1xzob_ (1xzo B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [102460] (2 PDB entries)

8. Domain d1xzob_: 1xzo B: [122475]
   automated match to d1on4a_
   complexed with ca, cd

Details for d1xzob_

PDB Entry: 1xzo, 1.7 Å

PDB Description: identification of a disulfide switch in bssco, a member of the sco family of cytochrome c oxidase assembly proteins

PDB Compounds: (B:) Hypothetical protein ypmQ

SCOPe Domain Sequences for d1xzob_:

Sequence, based on SEQRES records:

>d1xzob_ c.47.1.10 (B:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}
qqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkk
lkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfka
ivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk

Sequence, based on observed residues (ATOM records):

>d1xzob_ c.47.1.10 (B:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}
qqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkk
lkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfka
ivkkpegdqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk

Timeline for d1xzob_:

• d1xzob_ first appeared in SCOP 1.73, called d1xzob1
  
• d1xzob_ appears in SCOPe 2.07