SCOPe 2.07: Domain d1xzna_: 1xzn A:

Lineage for d1xzna_ (1xzn A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Pyrimidine operon regulator PyrR [109612] (4 species)
   bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities

7. Species Bacillus caldolyticus [TaxId:1394] [110659] (4 PDB entries)
   Uniprot P41007

8. Domain d1xzna_: 1xzn A: [122472]
   automated match to d1nona_
   complexed with mg, so4

Details for d1xzna_

PDB Entry: 1xzn, 2.27 Å

PDB Description: pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, sulfate-bound form

PDB Compounds: (A:) PyrR bifunctional protein

SCOPe Domain Sequences for d1xzna_:

Sequence, based on SEQRES records:

>d1xzna_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek

Sequence, based on observed residues (ATOM records):

>d1xzna_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
hrelpiradfvgknvptsrselivvelsevdgidqvsihek

Timeline for d1xzna_:

• d1xzna_ first appeared in SCOP 1.73, called d1xzna1
  
• d1xzna_ appears in SCOPe 2.06
  
• d1xzna_ appears in the current release, SCOPe 2.08