Lineage for d1xz9a1 (1xz9 A:6-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785886Protein Afadin [141269] (1 species)
  7. 2785887Species Human (Homo sapiens) [TaxId:9606] [141270] (2 PDB entries)
    Uniprot P55196 985-1079! Uniprot P55196 987-1077
  8. 2785889Domain d1xz9a1: 1xz9 A:6-101 [122471]
    Other proteins in same PDB: d1xz9a2

Details for d1xz9a1

PDB Entry: 1xz9 (more details)

PDB Description: structure of af-6 pdz domain
PDB Compounds: (A:) Afadin

SCOPe Domain Sequences for d1xz9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xz9a1 b.36.1.1 (A:6-101) Afadin {Human (Homo sapiens) [TaxId: 9606]}
lrkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqlls
vdgrslvglsqeraaelmtrtssvvtlevakqgaiy

SCOPe Domain Coordinates for d1xz9a1:

Click to download the PDB-style file with coordinates for d1xz9a1.
(The format of our PDB-style files is described here.)

Timeline for d1xz9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xz9a2