SCOPe 2.02: Domain d1xz0c1: 1xz0 C:184-277

Lineage for d1xz0c1 (1xz0 C:184-277)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (4 species)

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (3 PDB entries)

8. Domain d1xz0c1: 1xz0 C:184-277 [122464]
   Other proteins in same PDB: d1xz0a2, d1xz0b_, d1xz0c2, d1xz0d_
   automatically matched to d1onqa1
   complexed with jh0

Details for d1xz0c1

PDB Entry: 1xz0, 2.8 Å

PDB Description: crystal structure of cd1a in complex with a synthetic mycobactin lipopeptide

PDB Compounds: (C:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1xz0c1:

Sequence; same for both SEQRES and ATOM records:

>d1xz0c1 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlyw

Timeline for d1xz0c1:

• d1xz0c1 first appeared in SCOP 1.73
  
• d1xz0c1 appears in SCOPe 2.01
  
• d1xz0c1 appears in SCOPe 2.03
  
• d1xz0c1 appears in the current release, SCOPe 2.08