Lineage for d1xz0a1 (1xz0 A:184-277)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106653Protein CD1, alpha-3 domain [88615] (4 species)
  7. 1106654Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (3 PDB entries)
  8. 1106658Domain d1xz0a1: 1xz0 A:184-277 [122461]
    Other proteins in same PDB: d1xz0a2, d1xz0b_, d1xz0c2, d1xz0d_
    automatically matched to d1onqa1
    complexed with jh0

Details for d1xz0a1

PDB Entry: 1xz0 (more details), 2.8 Å

PDB Description: crystal structure of cd1a in complex with a synthetic mycobactin lipopeptide
PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1xz0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xz0a1 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d1xz0a1:

Click to download the PDB-style file with coordinates for d1xz0a1.
(The format of our PDB-style files is described here.)

Timeline for d1xz0a1: