Lineage for d1xyr11 (1xyr 1:71-302)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2821779Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2821837Protein Poliovirus coat proteins [49666] (3 species)
  7. 2821838Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (13 PDB entries)
  8. 2821873Domain d1xyr11: 1xyr 1:71-302 [122460]
    automatically matched to d1pov1_

Details for d1xyr11

PDB Entry: 1xyr (more details)

PDB Description: poliovirus 135s cell entry intermediate
PDB Compounds: (1:) Genome polyprotein, Coat protein VP1

SCOPe Domain Sequences for d1xyr11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyr11 b.121.4.1 (1:71-302) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
srsessiesffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrklefftysrf
dmeltfvvtanftetnnghalnqvyqimyvppgapvpekwddytwqtssnpsifytygta
parisvpyvgisnayshfydgfskvplkdqsaalgdslygaaslndfgilavrvvndhnp
tkvtskirvylkpkhirvwcprppravayygpgvdykdgtltplstkdltty

SCOPe Domain Coordinates for d1xyr11:

Click to download the PDB-style file with coordinates for d1xyr11.
(The format of our PDB-style files is described here.)

Timeline for d1xyr11: