Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (17 species) |
Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (6 PDB entries) |
Domain d1xydb1: 1xyd B:0-91 [122458] automatically matched to d1b4ca_ complexed with ca, zn |
PDB Entry: 1xyd (more details)
SCOPe Domain Sequences for d1xydb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xydb1 a.39.1.2 (B:0-91) Calcyclin (S100) {Rat (Rattus norvegicus), s100b [TaxId: 10116]} mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet ldedgdgecdfqefmafvsmvttacheffehe
Timeline for d1xydb1: