SCOPe 2.02: Domain d1xydb1: 1xyd B:0-91

Lineage for d1xydb1 (1xyd B:0-91)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (6 PDB entries)

8. Domain d1xydb1: 1xyd B:0-91 [122458]
   automatically matched to d1b4ca_
   complexed with ca, zn

Details for d1xydb1

PDB Entry: 1xyd

PDB Description: nmr solution structure of rat zinc-calcium-s100b, 20 structures

PDB Compounds: (B:) S-100 protein, beta chain

SCOPe Domain Sequences for d1xydb1:

Sequence; same for both SEQRES and ATOM records:

>d1xydb1 a.39.1.2 (B:0-91) Calcyclin (S100) {Rat (Rattus norvegicus), s100b [TaxId: 10116]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

Timeline for d1xydb1:

• d1xydb1 first appeared in SCOP 1.73
  
• d1xydb1 appears in SCOPe 2.01
  
• d1xydb1 appears in SCOPe 2.03
  
• d1xydb1 appears in the current release, SCOPe 2.08, called d1xydb_