Lineage for d1xydb1 (1xyd B:0-91)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640684Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 640685Protein Calcyclin (S100) [47479] (17 species)
  7. 640805Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (6 PDB entries)
  8. 640817Domain d1xydb1: 1xyd B:0-91 [122458]
    automatically matched to d1b4ca_
    complexed with ca, zn

Details for d1xydb1

PDB Entry: 1xyd (more details)

PDB Description: NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures
PDB Compounds: (B:) S-100 protein, beta chain

SCOP Domain Sequences for d1xydb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xydb1 a.39.1.2 (B:0-91) Calcyclin (S100) {Rat (Rattus norvegicus), s100b [TaxId: 10116]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1xydb1:

Click to download the PDB-style file with coordinates for d1xydb1.
(The format of our PDB-style files is described here.)

Timeline for d1xydb1: