Lineage for d1xy3f1 (1xy3 F:1-136)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730177Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 730178Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 730408Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)
  6. 730409Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 730443Species Aspergillus flavus [TaxId:5059] [55635] (15 PDB entries)
  8. 730514Domain d1xy3f1: 1xy3 F:1-136 [122451]
    automatically matched to d1r4sa1
    complexed with gun

Details for d1xy3f1

PDB Entry: 1xy3 (more details), 3.2 Å

PDB Description: urate oxidase from aspergillus flavus complexed with guanine
PDB Compounds: (F:) Uricase

SCOP Domain Sequences for d1xy3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xy3f1 d.96.1.4 (F:1-136) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

SCOP Domain Coordinates for d1xy3f1:

Click to download the PDB-style file with coordinates for d1xy3f1.
(The format of our PDB-style files is described here.)

Timeline for d1xy3f1: