Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein) |
Protein Urate oxidase (uricase) [55634] (3 species) duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16 |
Species Aspergillus flavus [TaxId:5059] [55635] (15 PDB entries) |
Domain d1xy3e1: 1xy3 E:1-136 [122449] automatically matched to d1r4sa1 complexed with gun |
PDB Entry: 1xy3 (more details), 3.2 Å
SCOP Domain Sequences for d1xy3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xy3e1 d.96.1.4 (E:1-136) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]} savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf irdseekrnvqvdvve
Timeline for d1xy3e1: